Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 18 of 18 results

(reset)

PNPO Rabbit Polyclonal Antibody

TA372342

USD 380.00

4 Weeks

PNPO rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human PNPO

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PNPO Rabbit Polyclonal Antibody

TA371467

USD 380.00

4 Weeks

PNPO rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human PNPO

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PNPO Rabbit Polyclonal Antibody

TA344305

USD 475.00

5 Days

Rabbit Polyclonal Anti-PNPO Antibody - N-terminal region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PNPO antibody: synthetic peptide directed towards the N terminal of human PNPO. Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

PNPO Mouse Monoclonal Antibody [Clone ID: OTI2F8]

CF503178

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI3B3]

CF503249

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI1H9]

CF503356

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI1G9]

CF503506

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

PNPO Rabbit Polyclonal Antibody

TA367200

USD 380.00

4 Weeks

PNPO rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human PNPO

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PNPO Rabbit Polyclonal Antibody

TA368105

USD 380.00

4 Weeks

PNPO rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human PNPO

PNPO Rabbit Polyclonal Antibody

TA380107

USD 220.00

3 Weeks

PNPO Rabbit polyclonal Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PNPO.

PNPO Mouse Monoclonal Antibody [Clone ID: OTI2F8]

TA503178

USD 379.00

In Stock

PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI2F8]

TA503178S

USD 159.00

2 Days

PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI3B3]

TA503249

USD 379.00

In Stock

PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI3B3]

TA503249S

USD 159.00

2 Days

PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI1H9]

TA503356

USD 379.00

In Stock

PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI1H9]

TA503356S

USD 159.00

2 Days

PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI1G9]

TA503506

USD 379.00

In Stock

PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

PNPO Mouse Monoclonal Antibody [Clone ID: OTI1G9]

TA503506S

USD 159.00

2 Days

PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

1 - 18 of 18 results