Antibodies

View as table Download

Rabbit Polyclonal CSN8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CSN8 antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human CSN8.

Rabbit Polyclonal Anti-COPS8 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COPS8 antibody: synthetic peptide directed towards the middle region of human COPS8. Synthetic peptide located within the following region: TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE

COPS8 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COPS8 antibody is: synthetic peptide directed towards the N-terminal region of Human CSN8

COPS8 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human COPS8

COPS8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human COPS8

COPS8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human COPS8

COPS8 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-209 of human COPS8 (NP_006701.1).
Modifications Unmodified