Rabbit Polyclonal CSN8 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CSN8 antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human CSN8. |
Rabbit Polyclonal CSN8 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CSN8 antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human CSN8. |
Rabbit Polyclonal Anti-COPS8 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS8 antibody: synthetic peptide directed towards the middle region of human COPS8. Synthetic peptide located within the following region: TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE |
COPS8 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-COPS8 antibody is: synthetic peptide directed towards the N-terminal region of Human CSN8 |
COPS8 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human COPS8 |
COPS8 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human COPS8 |
COPS8 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human COPS8 |
COPS8 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-209 of human COPS8 (NP_006701.1). |
Modifications | Unmodified |