Antibodies

View as table Download

IRF5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IRF5

IRF5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IRF5

Goat Polyclonal Antibody against IRF5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGPWPMHPAGMQ, from the C Terminus of the protein sequence according to NP_002191.1; NP_116032.1; NP_001092097.1; NP_001092099.1.

Rabbit polyclonal IRF5 Antibody (N-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IRF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 81-108 amino acids from the N-terminal region of human IRF5.

Rabbit polyclonal anti-IRF5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human IRF5.

Rabbit Polyclonal Anti-IRF5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the middle region of human IRF5. Synthetic peptide located within the following region: IFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQ

Rabbit Polyclonal Anti-IRF5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF5 Antibody: synthetic peptide directed towards the N terminal of human IRF5. Synthetic peptide located within the following region: PTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQD

Rabbit Polyclonal Anti-IRF5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the N terminal of mouse IRF5. Synthetic peptide located within the following region: CSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAP

Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IRF5

IRF5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2).
Modifications Unmodified

IRF5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2).
Modifications Unmodified

IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF5 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF5 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated