Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA |
Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA |
Rabbit Polyclonal Anti-GLA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |