PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
Rabbit Polyclonal Anti-PRPF19 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
Rabbit Polyclonal Anti-PRPF19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the N terminal of human PRPF19. Synthetic peptide located within the following region: VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP |