Rabbit polyclonal Cytochrome P450 2W1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2W1. |
Rabbit polyclonal Cytochrome P450 2W1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2W1. |
Rabbit Polyclonal Anti-CYP2W1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2W1 antibody: synthetic peptide directed towards the C terminal of human CYP2W1. Synthetic peptide located within the following region: PVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAA |
Rabbit Polyclonal Anti-CYP2W1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2W1 |