KCNJ8 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 4-33 amino acids from the N-terminal region of human KCNJ8 |
KCNJ8 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 4-33 amino acids from the N-terminal region of human KCNJ8 |
Rabbit Polyclonal Anti-KCNJ8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNJ8 antibody: synthetic peptide directed towards the middle region of human KCNJ8. Synthetic peptide located within the following region: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK |