Antibodies

View as table Download

Rabbit Polyclonal Anti-STS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY

Rabbit Polyclonal Anti-STS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STS antibody: synthetic peptide directed towards the C terminal of human STS. Synthetic peptide located within the following region: LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW

Goat Polyclonal Antibody against STS

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAGQKIDEPTSN, from the internal region of the protein sequence according to NP_000342.2.