CYP11B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP11B1 |
CYP11B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP11B1 |
Rabbit polyclonal Cytochrome P450 11B1/2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 11B1/2. |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the middle region of human CYP11B1. Synthetic peptide located within the following region: LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP11B1 |
CYP11B1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP11B1 |
CYP11B1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 234-503 of human CYP11B1 (NP_000488.3). |
Modifications | Unmodified |