Antibodies

Jump to Filters
View as table Download
HSD3B7 Rabbit Polyclonal Antibody
TA339548

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSD3B7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B7 antibody: synthetic peptide directed towards the middle region of human HSD3B7. Synthetic peptide located within the following region: QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR
HSD3B7 Rabbit Polyclonal Antibody
TA350067

USD 345.00

In Stock

Rabbit Polyclonal Anti-HSD3B7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B7
HSD3B7 Rabbit Polyclonal Antibody
TA364844

USD 380.00

4 Weeks

HSD3B7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSD3B7