Antibodies

Jump to Filters
View as table Download
ZNF384 Rabbit Polyclonal Antibody
TA329348

USD 375.00

5 Days

Rabbit Polyclonal anti-ZNF384 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF384 antibody: synthetic peptide directed towards the middle region of human ZNF384. Synthetic peptide located within the following region: KKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQ
ZNF384 Rabbit Polyclonal Antibody
TA383557

USD 220.00

3 Weeks

ZNF384 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ZNF384 (NP_001035009.1).
Modifications Unmodified