Antibodies

View as table Download

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088)

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088)

Rabbit polyclonal anti-DMGDH antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DMGDH.

Rabbit polyclonal anti-PIPOX antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIPOX.

Rabbit polyclonal AOC3 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3.

Rabbit Polyclonal Anti-CTH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Rabbit Polyclonal Anti-PSAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSAT1 antibody: synthetic peptide directed towards the N terminal of human PSAT1. Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY

BHMT mouse monoclonal antibody, clone 3D6, Purified

Applications ELISA, WB
Reactivities Human

BHMT mouse monoclonal antibody, clone 3D6, Purified

Applications ELISA, WB
Reactivities Human

Monoamine Oxidase A (MAOA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATM (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected between amino acids 70 and 100 of Human Glycine amidinotransferase

SDS (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human SDS.

Goat Anti-PSPH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-RQQVKDNAKWYITD, from the C-Terminus of the protein sequence according to NP_004568.2.

Anti-AGXT Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 280-294 amino acids of human alanine-glyoxylate aminotransferase

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV

Rabbit Polyclonal Anti-MAOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA

Rabbit Polyclonal Alas1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 480-530 of human ALAS-1 were used as the immunogen.

Rabbit Polyclonal Anti-CTH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the N terminal of human CTH. Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

AGXT rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human AGXT

Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human AMT

CBSL rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CBS

PHGDH (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human PHGDH

AOC2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog
Immunogen Synthetic peptide directed towards the middle region of human AOC2

GCAT (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 100-128 amino acids from the N-terminal region of human AKB ligase / GCAT

GLDC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 56~85 amino acids from the N-terminal region of Human GLDC

Goat Polyclonal Antibody against BHMT

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQQLKELFEKQK, from the C Terminus of the protein sequence according to NP_001704.1.

Goat Polyclonal Antibody against MAOB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3.

Goat Polyclonal Antibody against Monoamine Oxidase A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1.

Rabbit Polyclonal antibody to GLYCTK (glycerate kinase)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 144 and 523 of GLYCTK (Uniprot ID#Q8IVS8)

Goat Anti-DAO / D-amino-acid oxidase (aa286-298) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RPQIRLEREQLRT, from the internal region of the protein sequence according to NP_001908.3.

Anti-SHMT2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 240 amino acids of human serine hydroxymethyltransferase 2 (mitochondrial)

Rabbit Polyclonal anti-GAMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the middle region of human GAMT. Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI

Rabbit polyclonal Anti-SHMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA

Rabbit polyclonal Anti-MAOA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA

Rabbit polyclonal Anti-MAOA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE

Rabbit Polyclonal Anti-ALAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALAS1 Antibody: synthetic peptide directed towards the N terminal of human ALAS1. Synthetic peptide located within the following region: ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS

Rabbit Polyclonal Anti-AMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Rabbit Polyclonal Anti-Dmgdh Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE

Rabbit polyclonal Anti-PSPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA

Rabbit polyclonal Anti-PSPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE

Rabbit Polyclonal Anti-GLYCTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the N terminal of human GLYCTK. Synthetic peptide located within the following region: IQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGA

Rabbit Polyclonal Anti-GLYCTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the middle region of human GLYCTK. Synthetic peptide located within the following region: KPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI7B6 (formerly 7B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated