Rabbit anti-PDGFC polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | peptide coupled to KLH |
Rabbit anti-PDGFC polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | peptide coupled to KLH |
Rabbit anti-PDGFC polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Partial recombaint protein |
Rabbit Polyclonal Anti-PDGFC Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS |
Rabbit Polyclonal Anti-PDGFC Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDGFC |