PHYKPL (myc-DDK-tagged) - Human 5-phosphohydroxy-L-lysine phospho-lyase (PHYKPL), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PHYKPL (myc-DDK-tagged) - Human 5-phosphohydroxy-L-lysine phospho-lyase (PHYKPL), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ADAMTS15 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADAMTS15 |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AGXT2L2 |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the C terminal of human AGXT2L2. Synthetic peptide located within the following region: KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLS |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the N terminal of human AGXT2L2. Synthetic peptide located within the following region: QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRL |
PHYKPL CRISPRa kit - CRISPR gene activation of human 5-phosphohydroxy-L-lysine phospho-lyase
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
PHYKPL (GFP-tagged) - Human 5-phosphohydroxy-L-lysine phospho-lyase (PHYKPL), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PHYKPL (untagged) - Human 5-phosphohydroxy-L-lysine phospho-lyase (PHYKPL), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PHYKPL Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AGXT2L2 |
PHYKPL rabbit polyclonal antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PHYKPL |