Germany
Japan
United Kingdom
China
PHYKPL (myc-DDK-tagged) - Human 5-phosphohydroxy-L-lysine phospho-lyase (PHYKPL), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Antibodies
View as table Download
Rabbit Polyclonal Anti-AGXT2L2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AGXT2L2 |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the C terminal of human AGXT2L2. Synthetic peptide located within the following region: KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLS |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the N terminal of human AGXT2L2. Synthetic peptide located within the following region: QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRL |
PHYKPL CRISPRa kit - CRISPR gene activation of human 5-phosphohydroxy-L-lysine phospho-lyase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
PHYKPL (GFP-tagged) - Human 5-phosphohydroxy-L-lysine phospho-lyase (PHYKPL), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHYKPL (untagged) - Human 5-phosphohydroxy-L-lysine phospho-lyase (PHYKPL), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PHYKPL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AGXT2L2 |
PHYKPL rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHYKPL |
Active filters
Target Symbol
- PHYKPL