Antibodies

Jump to Filters
View as table Download
ELOVL7 Rabbit Polyclonal Antibody
TA306939

USD 430.00

In Stock

Rabbit Polyclonal ELOVL7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ELOVL7 antibody was raised against a 15 amino acid peptide near the amino terminus of human ELOVL7.
ELOVL7 Rabbit Polyclonal Antibody
TA338690

USD 310.00

5 Days

Rabbit Polyclonal Anti-ELOVL7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELOVL7 antibody: synthetic peptide directed towards the N terminal of human ELOVL7. Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS