Antibodies

Jump to Filters
View as table Download
RPL32 Rabbit Polyclonal Antibody
TA345692

USD 410.00

5 Days

Rabbit Polyclonal Anti-RPL32 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL32 antibody: synthetic peptide directed towards the N terminal of human RPL32. Synthetic peptide located within the following region: AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG
RPL32 Rabbit Polyclonal Antibody
TA381057

USD 220.00

3 Weeks

RPL32 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RPL32 (NP_000985.1).
Modifications Unmodified