Antibodies

View as table Download

UHRF1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human UHRF1

Rabbit Polyclonal Anti-UHRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UHRF1 antibody: synthetic peptide directed towards the N terminal of human UHRF1. Synthetic peptide located within the following region: MGVFAVPPLSADTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFH

Rabbit polyclonal UHRF1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This UHRF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 229-257 amino acids from the Central region of human UHRF1.

Mouse Monoclonal UHRF1 (N-terminus) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

UHRF1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human UHRF1

MonoMethyl-UHRF1-K385 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic monomethylated peptide around K385 of human UHRF1 (NP_001041666.1).
Modifications DiMethyl K385