Vgll4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Vgll4. |
Vgll4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Vgll4. |
Vgll4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Vgll4. |
Rabbit Polyclonal Anti-VGLL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: GLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNL |
Rabbit Polyclonal Anti-VGLL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: HSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSI |