Antibodies

Jump to Filters
View as table Download
ADAMTS19 Rabbit Polyclonal Antibody
TA345497

USD 475.00

5 Days

Rabbit Polyclonal Anti-ADAMTS19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAMTS19 antibody: synthetic peptide directed towards the N terminal of human ADAMTS19. Synthetic peptide located within the following region: MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP
ADAMTS19 Rabbit Polyclonal Antibody
TA322084

USD 345.00

In Stock

Anti-ADAMTS19 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 301-314 amino acids of human ADAM metallopeptidase with thrombospondin type 1 motif, 19