Rabbit Polyclonal Anti-TMEM195 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the N terminal of human TMEM195. Synthetic peptide located within the following region: MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL |
Rabbit Polyclonal Anti-TMEM195 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the N terminal of human TMEM195. Synthetic peptide located within the following region: VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP |
Rabbit Polyclonal Anti-TMEM195 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the middle region of human TMEM195. Synthetic peptide located within the following region: AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF |
Germany
Japan
United Kingdom
China