AKR7A3 mouse monoclonal antibody, clone AT2E11, Purified
Applications | ELISA, WB |
Reactivities | Human |
AKR7A3 mouse monoclonal antibody, clone AT2E11, Purified
Applications | ELISA, WB |
Reactivities | Human |
AKR7A3 mouse monoclonal antibody, clone AT2E11, Purified
Applications | ELISA, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-AKR7A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AKR7A3 antibody: synthetic peptide directed towards the middle region of human AKR7A3. Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW |
AKR7A3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKR7A3 |
AKR7A3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human AKR7A3 |
AKR7A3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human AKR7A3 (NP_036199.2). |
Modifications | Unmodified |