Antibodies

Jump to Filters
View as table Download
Ankrd13c Rabbit Polyclonal Antibody
TA346642

USD 475.00

5 Days

Rabbit Polyclonal Anti-Ankrd13c Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ankrd13c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ankrd13c. Synthetic peptide located within the following region: EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK
ANKRD13C (N-term) Rabbit Polyclonal Antibody
AP50182PU-N

USD 450.00

2 Weeks

ANKRD13C (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of human ANKRD13C