Antibodies

View as table Download

ANKRD46 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human ANR46

Rabbit Polyclonal Anti-Ankrd46 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ankrd46 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Ankrd46. Synthetic peptide located within the following region: FRTTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPELVH

ANKRD46 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANKRD46.