ANKRD46 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human ANR46 |
ANKRD46 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human ANR46 |
Rabbit Polyclonal Anti-Ankrd46 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ankrd46 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Ankrd46. Synthetic peptide located within the following region: FRTTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPELVH |
ANKRD46 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANKRD46. |