Rabbit Polyclonal Anti-ANXA8L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the middle region of human ANXA8L2. Synthetic peptide located within the following region: VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA |
Rabbit Polyclonal Anti-ANXA8L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the N terminal of human ANXA8L2. Synthetic peptide located within the following region: PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET |
ANXA8L2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ANXA8 |
ANXA8L2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AXA82 |
ANXA8L2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-276 of human ANXA8L2 (NP_001265853.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
