Antibodies

View as table Download

Rabbit Polyclonal Anti-APOBEC3D Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOBEC3D antibody: synthetic peptide directed towards the N terminal of human APOBEC3D. Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE

Rabbit polyclonal APOBEC3D/F antibody

Applications IHC, WB
Reactivities Human
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APOBEC3D/F.

Goat Anti-APOBEC3D (aa61-74) Antibody

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-PKRQSNHRQEVYFR, from the internal region of the protein sequence according to NP_689639.2.

Rabbit Polyclonal Anti-APOBEC3D Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human APOBEC3D

APOBEC3D Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human APOBEC3D

APOBEC3D Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human APOBEC3D (NP_689639.2).
Modifications Unmodified