Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 15 results

(reset)

Coatomer subunit delta (ARCN1) Rabbit Polyclonal Antibody

TA372259

USD 380.00

4 Weeks

ARCN1 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human ARCN1

1 / 2

2 / 2

Previous Next

Coatomer subunit delta (ARCN1) Rabbit Polyclonal Antibody

TA308389

USD 415.00

5 Days

Rabbit polyclonal antibody to COPD (archain 1)

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 89 and 511 of COPD (Uniprot ID#P48444)

1 / 2

2 / 2

Previous Next

Coatomer subunit delta (ARCN1) Rabbit Polyclonal Antibody

TA335019

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARCN1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ARCN1 antibody: synthetic peptide directed towards the middle region of human ARCN1. Synthetic peptide located within the following region: GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody [Clone ID: OTI4H9]

CF504314

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARCN1 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]

CF504315

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARCN1 mouse monoclonal antibody, clone OTI6A6 (formerly 6A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ARCN1 Rabbit Polyclonal Antibody

TA368019

USD 380.00

4 Weeks

ARCN1 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human ARCN1

Coatomer subunit delta (ARCN1) Rabbit Polyclonal Antibody

TA373633

USD 220.00

3 Weeks

ARCN1 Rabbit polyclonal Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 212-511 of human ARCN1 (NP_001646.2).
Modifications	Unmodified

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody [Clone ID: OTI4H9]

TA504314

USD 379.00

In Stock

ARCN1 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]

TA504314AM

USD 420.00

4 Weeks

ARCN1 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H9]

TA504314BM

USD 420.00

4 Weeks

ARCN1 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody [Clone ID: OTI4H9]

TA504314S

USD 159.00

In Stock

ARCN1 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]

TA504315

USD 379.00

In Stock

ARCN1 mouse monoclonal antibody, clone OTI6A6 (formerly 6A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A6]

TA504315AM

USD 420.00

4 Weeks

ARCN1 mouse monoclonal antibody, clone OTI6A6 (formerly 6A6), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A6]

TA504315BM

USD 420.00

4 Weeks

ARCN1 mouse monoclonal antibody, clone OTI6A6 (formerly 6A6), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Coatomer subunit delta (ARCN1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]

TA504315S

USD 159.00

2 Days

ARCN1 mouse monoclonal antibody, clone OTI6A6 (formerly 6A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

1 - 15 of 15 results