Rabbit Polyclonal Anti-ARFGAP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARFGAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human ARFGAP2. Synthetic peptide located within the following region: AAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSG |
Rabbit Polyclonal Anti-ARFGAP29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF289 antibody: synthetic peptide directed towards the N terminal of human ZNF289. Synthetic peptide located within the following region: YREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPA |
ARFGAP2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 242-521 of human ARFGAP2 (NP_115765.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
