Rabbit Polyclonal Anti-ARHGAP28 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-ARHGAP28 Antibody: synthetic peptide directed towards the C terminal of human ARHGAP28. Synthetic peptide located within the following region: AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD |
Rabbit Polyclonal Anti-ARHGAP28 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-ARHGAP28 Antibody: synthetic peptide directed towards the N terminal of human ARHGAP28. Synthetic peptide located within the following region: KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNI |
ARHGAP28 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
