Rabbit polyclonal anti-ARHGDIG antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ARHGDIG. |
Rabbit polyclonal anti-ARHGDIG antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ARHGDIG. |
Goat Anti-ARHGDIG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EAVPEYRAPGRK, from the C Terminus of the protein sequence according to NP_001167.2. |
Rabbit Polyclonal Anti-ARHGDIG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARHGDIG antibody: synthetic peptide directed towards the N terminal of human ARHGDIG. Synthetic peptide located within the following region: DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN |