Antibodies

View as table Download

Rabbit polyclonal anti-ARHGDIG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human ARHGDIG.

Goat Anti-ARHGDIG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EAVPEYRAPGRK, from the C Terminus of the protein sequence according to NP_001167.2.

Rabbit Polyclonal Anti-ARHGDIG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGDIG antibody: synthetic peptide directed towards the N terminal of human ARHGDIG. Synthetic peptide located within the following region: DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN