Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ASCL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ASCL2. |
Antibodies
View as table Download
ASCL2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 38-65 amino acids from the N-terminal region of human ASCL2 |
Rabbit Polyclonal Anti-ASCL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the middle region of human ASCL2. Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL |
Rabbit Polyclonal Anti-ASCL2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the C terminal of mouse ASCL2. Synthetic peptide located within the following region: PHGGANKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAGGLLTPATPP |
Rabbit Polyclonal Anti-ASCL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYI |
Rabbit Polyclonal Anti-ASCL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the C terminal of human ASCL2. Synthetic peptide located within the following region: RPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDS |
Active filters
Target Symbol
- ASCL2