Antibodies

Jump to Filters
View as table Download
ATX2 (ATXN2) Rabbit Polyclonal Antibody
TA335796

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATXN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATXN2 Antibody: synthetic peptide directed towards the middle region of human ATXN2. Synthetic peptide located within the following region: HAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQ
ATX2 (ATXN2) Rabbit Polyclonal Antibody
TA373860

USD 220.00

3 Weeks

ATXN2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ATXN2
Modifications Unmodified