Rabbit Polyclonal Anti-AUP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aup1 antibody is synthetic peptide directed towards the N-terminal region of Mouse Aup1. Synthetic peptide located within the following region: MPKDSAFPGAPAALRRWRRQRPRSPEAAAMEPPPAPGPERLFDSHRLPSD |
USD 450.00
2 Weeks
Ancient ubiquitous protein 1 (AUP1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 439-468 amino acids from the C-terminal region of human AUP1 |
Anti-AUP1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human ancient ubiquitous protein 1 |
Germany
Japan
United Kingdom
China
