Antibodies

View as table Download

Rabbit polyclonal anti-ACBD6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACBD6.

Rabbit Polyclonal Anti-ACBD6 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Acbd6 antibody is: synthetic peptide directed towards the middle region of Rat Acbd6. Synthetic peptide located within the following region: SEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHITKAIK

Rabbit Polyclonal Anti-ACBD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACBD6 antibody: synthetic peptide directed towards the middle region of human ACBD6. Synthetic peptide located within the following region: EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI

ACBD6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-282 of human ACBD6 (NP_115736.1).
Modifications Unmodified