Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ACBD6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACBD6. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACBD6 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Acbd6 antibody is: synthetic peptide directed towards the middle region of Rat Acbd6. Synthetic peptide located within the following region: SEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHITKAIK |
Rabbit Polyclonal Anti-ACBD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACBD6 antibody: synthetic peptide directed towards the middle region of human ACBD6. Synthetic peptide located within the following region: EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI |
ACBD6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-282 of human ACBD6 (NP_115736.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ACBD6