Antibodies

View as table Download

Rabbit Polyclonal Anti-ACTR1A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTR1A antibody: synthetic peptide directed towards the middle region of human ACTR1A. Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP

Anti-ACTR1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)

ACTR1A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 97-126 amino acids from the Central region of human ACTR1A

Goat Polyclonal Antibody against ARP1 homolog A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-YEEDGARSIHRKT, from the C Terminus of the protein sequence according to NP_005727.1.

Anti-ACTR1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)

ACTR1A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACTR1A

ACTR1A Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified