Rabbit Polyclonal Anti-ADAMTSL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADAMTSL1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADAMTSL1. Synthetic peptide located within the following region: EDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNV |
Rabbit Polyclonal Anti-ADAMTSL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADAMTSL1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADAMTSL1. Synthetic peptide located within the following region: STVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRL |
Anti-ADAMTSL1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 116-329 amino acids of human ADAMTS-like 1 |
ADAMTSL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1483-1762 of human ADAMTSL1 (NP_001035362.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
