Antibodies

Jump to Filters
View as table Download
AGXT2 Rabbit Polyclonal Antibody
TA346847

USD 475.00

5 Days

Rabbit Polyclonal Anti-AGXT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGXT2 antibody: synthetic peptide directed towards the N terminal of human AGXT2. Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK
AGXT2 (C-term) Rabbit Polyclonal Antibody
AP50116PU-N

USD 450.00

2 Weeks

AGXT2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 443~473 amino acids from the C-terminal region of human AGXT2
AGXT2 Rabbit Polyclonal Antibody
TA373369

USD 220.00

3 Weeks

AGXT2 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AGXT2.