Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SCYE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCYE1 antibody: synthetic peptide directed towards the N terminal of human SCYE1. Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF |
Rabbit polyclonal antibody to EMAP II (small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 263 of AIMP1 (Uniprot ID#Q12904) |
Rabbit Polyclonal Anti-SCYE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCYE1 antibody: synthetic peptide directed towards the middle region of human SCYE1. Synthetic peptide located within the following region: GTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQSIAGSADSKPIDVSRLDL |
EMAP II (Endothelial Monocyte Activating Polypeptide II), mouse anti human / rat, clone 546-2 Biotin
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
TA363827 is a replacement of BM4115S.
EMAP II (AIMP1) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human MCA1 |
Goat Anti-AIMP1 / SCYE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NNDAVLKRLEQK-C, from the N Terminus of the protein sequence according to NP_004748.2; NP_001135888.1. |
Rabbit Polyclonal Anti-AIMP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AIMP1 |
AIMP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AIMP1 |
EMAP II Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- AIMP1