Antibodies

View as table Download

Rabbit Polyclonal Anti-AP1M2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1M2 antibody: synthetic peptide directed towards the N terminal of human AP1M2. Synthetic peptide located within the following region: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

AP1M2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 164-423 of human AP1M2 (NP_005489.2).
Modifications Unmodified