Rabbit Polyclonal Anti-ATOH7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATOH7 antibody: synthetic peptide directed towards the C terminal of human ATOH7. Synthetic peptide located within the following region: FGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMA |
Rabbit Polyclonal Anti-Atoh7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atoh7 antibody: synthetic peptide directed towards the C terminal of mouse Atoh7. Synthetic peptide located within the following region: IALTRILAEAERDWVGLRCEQRGRDHPYLPFPGARLQVDPEPYGQRLFGF |
Germany
Japan
United Kingdom
China