Antibodies

Jump to Filters
View as table Download
ATP2B4 Rabbit Polyclonal Antibody
TA335277

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP2B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2B4 antibody: synthetic peptide directed towards the middle region of human ATP2B4. Synthetic peptide located within the following region: FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK
ATP2B4 Rabbit Polyclonal Antibody
TA373817

USD 220.00

3 Weeks

ATP2B4 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1141-1205 of human ATP2B4 (NP_001675.3).
Modifications Unmodified