ATP6V0B (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 111-139 amino acids from the Central region of human ATP6V0B |
ATP6V0B (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 111-139 amino acids from the Central region of human ATP6V0B |
Rabbit Polyclonal Anti-Atp6v0b Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Atp6v0b Antibody is: synthetic peptide directed towards the N-terminal region of Rat Atp6v0b. Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG |