Antibodies

Jump to Filters
View as table Download
Aurora C (AURKC) Rabbit Polyclonal Antibody
TA313273

USD 345.00

In Stock

Rabbit polyclonal AurB/C (Ab-202/175) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AurB/C around the phosphorylation site of threonine 202/175 (C-G-TP-L-D).
Aurora C (AURKC) Goat Polyclonal Antibody
TA311161

USD 375.00

5 Days

Goat Anti-AURKC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PRAVVQLGKAQP-C, from the N Terminus of the protein sequence according to NP_001015878.1.
Aurora C (AURKC) Rabbit Polyclonal Antibody
TA324889

USD 450.00

5 Days

Rabbit polyclonal Aurora-C Antibody (N-term M1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C.
Aurora C (AURKC) Rabbit Polyclonal Antibody
TA324890

USD 450.00

5 Days

Rabbit polyclonal Aurora-C Antibody (N-term G11)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C.
Aurora C (AURKC) Rabbit Polyclonal Antibody
TA336082

USD 375.00

5 Days

Rabbit Polyclonal Anti-AURKC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AURKC Antibody: synthetic peptide directed towards the middle region of human AURKC. Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL
Aurora C (AURKC) Mouse Monoclonal Antibody [Clone ID: OTI4F7]
CF500553

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) AURKC mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Aurora C (AURKC) Mouse Monoclonal Antibody [Clone ID: OTI10A7]
CF500554

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) AURKC mouse monoclonal antibody, clone OTI10A7 (formerly 10A7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Aurora C (AURKC) Mouse Monoclonal Antibody [Clone ID: OTI2B7]
CF500602

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AURKC mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Aurora C (AURKC) Rabbit Polyclonal Antibody
TA350902

USD 345.00

In Stock

Rabbit Polyclonal Anti-AURKC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AURKC
Aurora C (AURKC) Rabbit Polyclonal Antibody
TA373868

USD 220.00

3 Weeks

AURKC Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AURKC (NP_001015878.1).
Aurora C (AURKC) Rabbit Polyclonal Antibody
TA373869

USD 220.00

3 Weeks

AURKC Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AURKC
Modifications Unmodified