Rabbit polyclonal Anti-B3GALNT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B3GALNT2 antibody: synthetic peptide directed towards the middle region of human B3GALNT2. Synthetic peptide located within the following region: PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL |
Rabbit polyclonal Anti-B3GALNT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B3GALNT2 antibody: synthetic peptide directed towards the middle region of human B3GALNT2. Synthetic peptide located within the following region: GKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSMG |
Carrier-free (BSA/glycerol-free) B3GALNT2 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
B3GALNT2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human B3GALNT2 |
B3GALNT2 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
B3GALNT2 mouse monoclonal antibody,clone 1G2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
B3GALNT2 mouse monoclonal antibody,clone 1G2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
B3GALNT2 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
