Antibodies

View as table Download

Rabbit Polyclonal Anti-BBS1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bbs1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI

BBS1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human BBS1