Rabbit Polyclonal antibody to BCAP31 (B-cell receptor-associated protein 31)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 246 of BCAP31 (Uniprot ID#P51572) |
Rabbit Polyclonal antibody to BCAP31 (B-cell receptor-associated protein 31)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 246 of BCAP31 (Uniprot ID#P51572) |
Rabbit Polyclonal BAP31 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAP31 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human BAP31. |
Rabbit Polyclonal BAP31 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAP31 antibody was raised against a 17 amino acid peptide from near the center of human BAP31. |
Goat Polyclonal Antibody against BCAP31
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QAAVDGPMDKKEE, from the C Terminus of the protein sequence according to NP_005736.3. |
Rabbit polyclonal BCAP31 Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This BCAP31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-147 amino acids from the Central region of human BCAP31. |
Rabbit Polyclonal Anti-BCAP31 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCAP31 antibody: synthetic peptide directed towards the middle region of human BCAP31. Synthetic peptide located within the following region: STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE |
Rabbit Polyclonal Anti-BCAP31 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BCAP31 |
BCAP31 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BCAP31 |
BCAP31 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BCAP31 |
BCAP31 Antibody - C-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BCAP31 |
BAP31 Rabbit polyclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 127-246 of human BAP31 (NP_001243376.1). |
Modifications | Unmodified |