Rabbit Polyclonal Anti-BRD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BRD9 antibody is: synthetic peptide directed towards the N-terminal region of Human BRD9. Synthetic peptide located within the following region: YYDDRSDHERERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREH |
BRD9 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BRD9 |
Rabbit Polyclonal Anti-BRD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD9 antibody: synthetic peptide directed towards the N terminal of human BRD9. Synthetic peptide located within the following region: AIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNR |
Rabbit Polyclonal Anti-BRD9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD9 antibody: synthetic peptide directed towards the N terminal of human BRD9. Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE |
BRD9 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BRD9 |
BRD9 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 338-597 of human BRD9 (NP_076413.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
