Germany
Japan
United Kingdom
China
BTBD16 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 36-66 amino acids from the N-terminal region of human BTBDG |
Antibodies
View as table Download
Rabbit Polyclonal Anti-BTBD16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BTBD16 Antibody is: synthetic peptide directed towards the N-terminal region of Human BTBD16. Synthetic peptide located within the following region: TLAKLYLKALAQGTTHPLRELEELLRAQSPKKTKEKSPAKRIIISLKIND |
Rabbit Polyclonal Anti-BTBD16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BTBD16 Antibody is: synthetic peptide directed towards the N-terminal region of Human BTBD16. Synthetic peptide located within the following region: DLLSLSQMCKALSIDFEEALRNPDRLCISQIQKFFFENFKNKDIQSGEAD |
Active filters
Target Symbol
- BTBD16