Antibodies

Jump to Filters
View as table Download
BTBD7 Rabbit Polyclonal Antibody
TA333756

USD 375.00

5 Days

Rabbit Polyclonal Anti-BTBD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BTBD7 Antibody is: synthetic peptide directed towards the N-terminal region of Human BTBD7. Synthetic peptide located within the following region: SPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSG
BTBD7 Rabbit Polyclonal Antibody
TA374101

USD 220.00

3 Weeks

BTBD7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BTBD7.