Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against Pallidin
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EREKQLTARPAKRM, from the C Terminus of the protein sequence according to NP_036520. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-BLOC1S6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLOC1S6 antibody: synthetic peptide directed towards the N terminal of human BLOC1S6. Synthetic peptide located within the following region: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE |
Rabbit Polyclonal Anti-BLOC1S6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLOC1S6 antibody: synthetic peptide directed towards the middle region of human BLOC1S6. Synthetic peptide located within the following region: EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL |
BLOC1S6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BLOC1S6 |
BLOC1S6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human BLOC1S6 (NP_036520.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- BLOC1S6