Rabbit Polyclonal Anti-C17orf75 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C17orf75 antibody: synthetic peptide directed towards the middle region of human C17orf75. Synthetic peptide located within the following region: KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE |
Rabbit Polyclonal Anti-C17orf75 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C17orf75 antibody: synthetic peptide directed towards the N terminal of human C17orf75. Synthetic peptide located within the following region: SSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPS |
Rabbit polyclonal antibody to Njmu-R1 (chromosome 17 open reading frame 75)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 215 of Njmu-R1 (Uniprot ID#Q9HAS0) |
C17ORF75 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C17ORF75 |
Germany
Japan
United Kingdom
China